PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna01311.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 712aa    MW: 78662.6 Da    PI: 6.42
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna01311.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.4e-16362409148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg WT+ Ed +l+ +v ++G g+W+ ++++ g++R++k+c++rw +yl
  mrna01311.1-v1.0-hybrid 362 RGLWTAAEDAKLLACVSKHGVGNWTVVPKKAGLNRCGKSCRLRWTNYL 409
                              788*******************************************97 PP

2Myb_DNA-binding48.91.5e-15417458346
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                               +T+eE+e +++++k  G++ W++Ia+ ++ gRt++++k++w++
  mrna01311.1-v1.0-hybrid 417 TFTPEEEEHIINLHKAIGSR-WSLIAKQLP-GRTDNDVKNYWNT 458
                              79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007022.0E-3196291IPR006620Prolyl 4-hydroxylase, alpha subunit
PfamPF136402.9E-798149IPR005123Oxoglutarate/iron-dependent dioxygenase
PROSITE profilePS5147112.836170292IPR005123Oxoglutarate/iron-dependent dioxygenase
PfamPF136401.9E-20174291IPR005123Oxoglutarate/iron-dependent dioxygenase
PfamPF015492.6E-4306345IPR003582ShKT domain
SMARTSM002541.4E-5306348IPR003582ShKT domain
PROSITE profilePS516708.348307348IPR003582ShKT domain
Gene3DG3DSA:1.10.10.602.1E-23353412IPR009057Homeodomain-like
PROSITE profilePS5129425.535357413IPR017930Myb domain
SuperFamilySSF466897.19E-31359456IPR009057Homeodomain-like
SMARTSM007177.8E-15361411IPR001005SANT/Myb domain
PfamPF002499.7E-15362409IPR001005SANT/Myb domain
CDDcd001673.13E-11365409No hitNo description
Gene3DG3DSA:1.10.10.601.5E-24413464IPR009057Homeodomain-like
SMARTSM007178.0E-14414462IPR001005SANT/Myb domain
PROSITE profilePS5129418.612414464IPR017930Myb domain
PfamPF002498.5E-14417458IPR001005SANT/Myb domain
CDDcd001672.36E-10417460No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0055114Biological Processoxidation-reduction process
GO:0003677Molecular FunctionDNA binding
GO:0005506Molecular Functioniron ion binding
GO:0016705Molecular Functionoxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0031418Molecular FunctionL-ascorbic acid binding
Sequence ? help Back to Top
Protein Sequence    Length: 712 aa     Download sequence    Send to blast
MEFVPCTILI GYFLISASSS SQTRFAFHLQ IAYSVILRYT DLVPEFRHTN SSQLDLVRVL  60
VLVRPQPLEK PSPFFERHQW LPVSSIDISE NGEGLQIILH YDHGQKYAPH YDSSSDKADQ  120
ELGGHRVATV LMYLSNVEKG GETAFPKAQD EVVANIETKI AAWTFLPIEN GEAMQILHYE  180
NGQKYEPHYD YFHDKANQEL GGHRVATVLM YLSNVEKGGE TVFPQAQVKT VEAKDEVLSD  240
CAKNGYSVKP FKGDALLFFS LLPNATTDPN SLHGSCPVIE GEKWSATKWI HVRSFEKSLK  300
KALSGECTDE NVNCATWAKA GECEKNPTYM VGSADLPGFC RKSCKILKMG RPPCCDKSNV  360
KRGLWTAAED AKLLACVSKH GVGNWTVVPK KAGLNRCGKS CRLRWTNYLR PDLKHDTFTP  420
EEEEHIINLH KAIGSRWSLI AKQLPGRTDN DVKNYWNTKL KKKLSKIGID PVTHKPISHV  480
LSDFGNITCL PHHIGDHLEP SFNNNLNTST TFVSESDPSS GITGLAYTNM VMMNPIMESH  540
DHSHTSTLPF GFLSQFQAMN QDDNVSLPPH FLNEVTSSCS SSSSPPATDL LSPQCHASAQ  600
VITPSSSPFN WSEFLLQDPL SSADQPKQEE VFHGVLSSPA NPTVNGIQSQ SFEVGSSSTI  660
NGGPSLNNNK NLANDHIASS SLSSFVDRII GQDSEMRAAL FPELLDGSFD Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3gze_A1e-559029270218Predicted protein
3gze_B1e-559029270218Predicted protein
3gze_C1e-559029270218Predicted protein
3gze_D1e-559029270218Predicted protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004304960.20.0PREDICTED: transcription factor RAX2 isoform X1
TrEMBLA0A078D7B00.0A0A078D7B0_BRANA; BnaC07g25120D protein
TrEMBLA0A0D3DC330.0A0A0D3DC33_BRAOL; Uncharacterized protein
STRINGVIT_14s0066g02180.t011e-112(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF847034
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.12e-75MYB family protein